Lineage for d5yxna2 (5yxn A:114-193)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750699Domain d5yxna2: 5yxn A:114-193 [361269]
    Other proteins in same PDB: d5yxna1, d5yxnb1, d5yxnb2, d5yxnc1, d5yxnc2
    automated match to d2ak4d2

Details for d5yxna2

PDB Entry: 5yxn (more details), 2.03 Å

PDB Description: a t cell receptor in complex with hla-a0201 restricted hepatitis c virus ns3 peptide (klvalginav)
PDB Compounds: (A:) T cell receptor alpha chain

SCOPe Domain Sequences for d5yxna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yxna2 b.1.1.2 (A:114-193) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnns

SCOPe Domain Coordinates for d5yxna2:

Click to download the PDB-style file with coordinates for d5yxna2.
(The format of our PDB-style files is described here.)

Timeline for d5yxna2: