Lineage for d5yxna1 (5yxn A:2-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756154Domain d5yxna1: 5yxn A:2-113 [361268]
    Other proteins in same PDB: d5yxna2, d5yxnc1, d5yxnc2, d5yxnd_
    automated match to d2ak4d1

Details for d5yxna1

PDB Entry: 5yxn (more details), 2.03 Å

PDB Description: a t cell receptor in complex with hla-a0201 restricted hepatitis c virus ns3 peptide (klvalginav)
PDB Compounds: (A:) T cell receptor alpha chain

SCOPe Domain Sequences for d5yxna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yxna1 b.1.1.0 (A:2-113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqtvtqsqpemsvqeaetvtlsctydtsesdyylfwykqppsrqmilvirqeaykqqnat
enrfsvnfqkaaksfslkisdsqlgdaamyfcaygeddkiifgkgtrlhilp

SCOPe Domain Coordinates for d5yxna1:

Click to download the PDB-style file with coordinates for d5yxna1.
(The format of our PDB-style files is described here.)

Timeline for d5yxna1: