Lineage for d5yxnc2 (5yxn C:183-276)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746844Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2746845Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2747022Domain d5yxnc2: 5yxn C:183-276 [361254]
    Other proteins in same PDB: d5yxna1, d5yxna2, d5yxnb1, d5yxnb2, d5yxnc1, d5yxnd_
    automated match to d1i4fa1

Details for d5yxnc2

PDB Entry: 5yxn (more details), 2.03 Å

PDB Description: a t cell receptor in complex with hla-a0201 restricted hepatitis c virus ns3 peptide (klvalginav)
PDB Compounds: (C:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d5yxnc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yxnc2 b.1.1.2 (C:183-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

SCOPe Domain Coordinates for d5yxnc2:

Click to download the PDB-style file with coordinates for d5yxnc2.
(The format of our PDB-style files is described here.)

Timeline for d5yxnc2: