Lineage for d5yxnc1 (5yxn C:2-182)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2506604Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2506631Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (102 PDB entries)
    Uniprot P01892 25-298
  8. 3061191Domain d5yxnc1: 5yxn C:2-182 [361253]
    Other proteins in same PDB: d5yxna1, d5yxna2, d5yxnb1, d5yxnb2, d5yxnc2, d5yxnd_
    automated match to d1i4fa2

Details for d5yxnc1

PDB Entry: 5yxn (more details), 2.03 Å

PDB Description: a t cell receptor in complex with hla-a0201 restricted hepatitis c virus ns3 peptide (klvalginav)
PDB Compounds: (C:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d5yxnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yxnc1 d.19.1.1 (C:2-182) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d5yxnc1:

Click to download the PDB-style file with coordinates for d5yxnc1.
(The format of our PDB-style files is described here.)

Timeline for d5yxnc1:

  • d5yxnc1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13