Lineage for d5z19d2 (5z19 D:186-278)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763285Species [ruminococcus] gnavus [TaxId:33038] [361225] (3 PDB entries)
  8. 2763293Domain d5z19d2: 5z19 D:186-278 [361238]
    Other proteins in same PDB: d5z19a1, d5z19a3, d5z19b1, d5z19b3, d5z19c1, d5z19c3, d5z19d1, d5z19d3, d5z19e1, d5z19e3, d5z19f1, d5z19f3
    automated match to d5c71a2
    complexed with sj5

Details for d5z19d2

PDB Entry: 5z19 (more details), 2.5 Å

PDB Description: the crystal structure of ruminococcus gnavus beta-glucuronidase in complex with uronic isofagomine
PDB Compounds: (D:) beta-glucuronidase

SCOPe Domain Sequences for d5z19d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z19d2 b.1.4.0 (D:186-278) automated matches {[ruminococcus] gnavus [TaxId: 33038]}
esvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqvanarl
wevrnaylyqivilitdgngvldeyrekigirt

SCOPe Domain Coordinates for d5z19d2:

Click to download the PDB-style file with coordinates for d5z19d2.
(The format of our PDB-style files is described here.)

Timeline for d5z19d2: