Lineage for d6iima_ (6iim A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2497848Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins)
    Pfam PF00443
  6. 2497849Protein Ubiquitin carboxyl-terminal hydrolase 14 [142860] (1 species)
  7. 2497850Species Human (Homo sapiens) [TaxId:9606] [142861] (6 PDB entries)
    Uniprot P54578 100-482
  8. 3061171Domain d6iima_: 6iim A: [361233]
    automated match to d2ayna1
    complexed with a8l

Details for d6iima_

PDB Entry: 6iim (more details), 2.21 Å

PDB Description: usp14 catalytic domain with iu1-206
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 14

SCOPe Domain Sequences for d6iima_:

Sequence, based on SEQRES records: (download)

>d6iima_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]}
elpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdlfd
smdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaiedd
svketdsssasaatpskkkslidqffgvefettmkcteseeeevtkgkenqlqlscfinq
evkylftglklrlqeeitkqsptlqrnalyiksskisrlpayltiqmvrffykekesvna
kvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnqqpntsdkksspqkevky
epfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfdddkvsivtpe
dilrlsgggdwhiayvllygprrv

Sequence, based on observed residues (ATOM records): (download)

>d6iima_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]}
elpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdlfd
smdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaiedk
slidqffgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitk
qsptlqrnalyiksskisrlpayltiqmvrffykevnakvlkdvkfplmldmyelctpel
qekmvsfrskfkdlepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdew
ikfdddkvsivtpedilrlsgggdwhiayvllygprrv

SCOPe Domain Coordinates for d6iima_:

Click to download the PDB-style file with coordinates for d6iima_.
(The format of our PDB-style files is described here.)

Timeline for d6iima_:

  • d6iima_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13