Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
Protein automated matches [254633] (19 species) not a true protein |
Species [ruminococcus] gnavus [TaxId:33038] [361225] (3 PDB entries) |
Domain d5z19f2: 5z19 F:186-278 [361231] Other proteins in same PDB: d5z19a1, d5z19a3, d5z19b1, d5z19b3, d5z19c1, d5z19c3, d5z19d1, d5z19d3, d5z19e1, d5z19e3, d5z19f1, d5z19f3 automated match to d5c71a2 complexed with sj5 |
PDB Entry: 5z19 (more details), 2.5 Å
SCOPe Domain Sequences for d5z19f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z19f2 b.1.4.0 (F:186-278) automated matches {[ruminococcus] gnavus [TaxId: 33038]} esvkdysvdyelcgtdalvkyevvttgehpvivrlldaegelvaetegkegilqvanarl wevrnaylyqivilitdgngvldeyrekigirt
Timeline for d5z19f2: