Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species [ruminococcus] gnavus [TaxId:33038] [361223] (3 PDB entries) |
Domain d5z19f1: 5z19 F:2-185 [361230] Other proteins in same PDB: d5z19a2, d5z19a3, d5z19b2, d5z19b3, d5z19c2, d5z19c3, d5z19d2, d5z19d3, d5z19e2, d5z19e3, d5z19f2, d5z19f3 automated match to d5c70a1 complexed with sj5 |
PDB Entry: 5z19 (more details), 2.5 Å
SCOPe Domain Sequences for d5z19f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z19f1 b.18.1.0 (F:2-185) automated matches {[ruminococcus] gnavus [TaxId: 33038]} leyselypiqneyrmmqsldgmwkfqfdpeeigkksgwenglpapvsmpvpssfadfftd hkerdycgdfwyetefylpaewrnkkiwlrfgsithrgtvycngmeitsheggflpvlad istvakpgqvnqvvvkinnelnetslpcgatkilnngrklakpyfdffnysglqrsvwvi alpe
Timeline for d5z19f1: