Lineage for d6n9kb_ (6n9k B:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2569658Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2569659Protein automated matches [190857] (49 species)
    not a true protein
  7. 3061139Species Escherichia coli [TaxId:83334] [361201] (1 PDB entry)
  8. 3061143Domain d6n9kb_: 6n9k B: [361205]
    Other proteins in same PDB: d6n9ka2
    automated match to d2wzxa_
    complexed with edo, gol, so4

Details for d6n9kb_

PDB Entry: 6n9k (more details), 1.6 Å

PDB Description: beta-lactamase from escherichia coli str. sakai
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6n9kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n9kb_ e.3.1.0 (B:) automated matches {Escherichia coli [TaxId: 83334]}
pqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelgs
vsktftgvlggdaiargeiklsdpatkywpeltakqwngitllhlatytagglplqvpde
vksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplkl
nhtwinvppaeeknyawgyregkavhvspgaldaetygvkstiedmacwvrsnmnprdin
dktlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdiivngsdnkialaarpvkaitpp
tpavraswvhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnalq

SCOPe Domain Coordinates for d6n9kb_:

Click to download the PDB-style file with coordinates for d6n9kb_.
(The format of our PDB-style files is described here.)

Timeline for d6n9kb_:

  • d6n9kb_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13