Lineage for d6n9ka1 (6n9k A:20-377)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2569658Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2569659Protein automated matches [190857] (55 species)
    not a true protein
  7. 3061139Species Escherichia coli [TaxId:83334] [361201] (1 PDB entry)
  8. 3061140Domain d6n9ka1: 6n9k A:20-377 [361202]
    Other proteins in same PDB: d6n9ka2
    automated match to d2wzxa_
    complexed with edo, gol, so4

Details for d6n9ka1

PDB Entry: 6n9k (more details), 1.6 Å

PDB Description: beta-lactamase from escherichia coli str. sakai
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6n9ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n9ka1 e.3.1.0 (A:20-377) automated matches {Escherichia coli [TaxId: 83334]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpatkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaetygvkstiedmacwvrsnmnprdi
ndktlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdiivngsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnalq

SCOPe Domain Coordinates for d6n9ka1:

Click to download the PDB-style file with coordinates for d6n9ka1.
(The format of our PDB-style files is described here.)

Timeline for d6n9ka1:

  • d6n9ka1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13

View in 3D
Domains from same chain:
(mouse over for more information)
d6n9ka2
View in 3D
Domains from other chains:
(mouse over for more information)
d6n9kb_