Lineage for d6hlfa_ (6hlf A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2426443Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2427608Protein R-specific alcohol dehydrogenase [89521] (1 species)
  7. 2427609Species Lactobacillus brevis [TaxId:1580] [89522] (5 PDB entries)
  8. 3061138Domain d6hlfa_: 6hlf A: [361200]
    automated match to d1nxqa_
    complexed with mg, mn; mutant

Details for d6hlfa_

PDB Entry: 6hlf (more details), 1.55 Å

PDB Description: x-ray structure of lactobacillus brevis alcohol dehydrogenase mutant - k32a
PDB Compounds: (A:) R-specific alcohol dehydrogenase

SCOPe Domain Sequences for d6hlfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hlfa_ c.2.1.2 (A:) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]}
snrldgkvaiitggtlgiglaiatkfveegaavmitgrhsdvgekaaksvgtpdqiqffq
hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
efvvdggytaq

SCOPe Domain Coordinates for d6hlfa_:

Click to download the PDB-style file with coordinates for d6hlfa_.
(The format of our PDB-style files is described here.)

Timeline for d6hlfa_:

  • d6hlfa_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13