Lineage for d6q4la_ (6q4l A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2464564Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2466053Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2466226Family c.56.5.2: Carboxypeptidase T [53198] (1 protein)
    automatically mapped to Pfam PF00246
  6. 2466227Protein Carboxypeptidase T [53199] (1 species)
  7. 2466228Species Thermoactinomyces vulgaris [TaxId:2026] [53200] (18 PDB entries)
  8. 3061137Domain d6q4la_: 6q4l A: [361199]
    automated match to d4gm5a_
    complexed with 3k0, ca, so4, zn; mutant

Details for d6q4la_

PDB Entry: 6q4l (more details), 2.3 Å

PDB Description: carboxypeptidase t mutant l254n with with n-sulfamoyl-l-glutamic acid
PDB Compounds: (A:) carboxypeptidase t

SCOPe Domain Sequences for d6q4la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q4la_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]}
dfpsydsgyhnynemvnkintvasnypnivkkfsigksyegrelwavkisdnvgtdenep
evlytalhharehltvemalytldlftqnynldsritnlvnnreiyivfninpdggeydi
ssgsykswrknrqpnsgssyvgtdlnrnygykwgccggssgspssetyrgrsafsapeta
amrdfinsrvvggkqqiktlitfhtyselilypygytytdvpsdmtqddfnvfktmantm
aqtngytpqqasdnyitdgdmtdwaygqhkifaftfemyptsynpgfyppdevigretsr
nkeavlyvaekadcpysvigksc

SCOPe Domain Coordinates for d6q4la_:

Click to download the PDB-style file with coordinates for d6q4la_.
(The format of our PDB-style files is described here.)

Timeline for d6q4la_:

  • d6q4la_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13