Lineage for d6imfa2 (6imf A:165-221)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2585562Fold g.19: Crisp domain-like [57545] (1 superfamily)
    disulfide-rich all-alpha fold
  4. 2585563Superfamily g.19.1: Crisp domain-like [57546] (3 families) (S)
  5. 2585576Family g.19.1.0: automated matches [227153] (1 protein)
    not a true family
  6. 2585577Protein automated matches [226858] (5 species)
    not a true protein
  7. 3061125Species Protobothrops flavoviridis [TaxId:88087] [361187] (1 PDB entry)
  8. 3061126Domain d6imfa2: 6imf A:165-221 [361188]
    Other proteins in same PDB: d6imfa1
    automated match to d1wvra2
    complexed with gol, mes

Details for d6imfa2

PDB Entry: 6imf (more details), 2.3 Å

PDB Description: crystal structure of toxin/antitoxin complex
PDB Compounds: (A:) Cysteine-rich venom protein triflin

SCOPe Domain Sequences for d6imfa2:

Sequence, based on SEQRES records: (download)

>d6imfa2 g.19.1.0 (A:165-221) automated matches {Protobothrops flavoviridis [TaxId: 88087]}
ppcgdcpsdcdnglctnpctreneftncdslvqksscqdnymkskcpascfcqnkii

Sequence, based on observed residues (ATOM records): (download)

>d6imfa2 g.19.1.0 (A:165-221) automated matches {Protobothrops flavoviridis [TaxId: 88087]}
ppcgdcpsdcdnglctnpctreneftncdslvdnymkskcpascfcqnkii

SCOPe Domain Coordinates for d6imfa2:

Click to download the PDB-style file with coordinates for d6imfa2.
(The format of our PDB-style files is described here.)

Timeline for d6imfa2:

  • d6imfa2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13