Lineage for d6imfa1 (6imf A:2-164)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535431Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 2535432Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 2535433Family d.111.1.1: PR-1-like [55798] (5 proteins)
    Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1
  6. 2535446Protein automated matches [194852] (4 species)
    not a true protein
  7. 3061123Species Protobothrops flavoviridis [TaxId:88087] [361185] (1 PDB entry)
  8. 3061124Domain d6imfa1: 6imf A:2-164 [361186]
    Other proteins in same PDB: d6imfa2
    automated match to d1wvra1
    complexed with gol, mes

Details for d6imfa1

PDB Entry: 6imf (more details), 2.3 Å

PDB Description: crystal structure of toxin/antitoxin complex
PDB Compounds: (A:) Cysteine-rich venom protein triflin

SCOPe Domain Sequences for d6imfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6imfa1 d.111.1.1 (A:2-164) automated matches {Protobothrops flavoviridis [TaxId: 88087]}
vdfdsesprkpeiqneiidlhnslrrsvnptasnmlkmewypeaaanaerwayrcieshs
srdsrviggikcgeniymatypakwtdiihawhgeykdfkygvgavpsdavighytqivw
yksyragcaaaycpsskysyfyvcqycpagniigktatpyksg

SCOPe Domain Coordinates for d6imfa1:

Click to download the PDB-style file with coordinates for d6imfa1.
(The format of our PDB-style files is described here.)

Timeline for d6imfa1:

  • d6imfa1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13