Lineage for d6n3ue_ (6n3u E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316392Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2316654Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2316655Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 2316661Protein HIV capsid protein, dimerisation domain [47359] (3 species)
  7. 3061113Species Human immunodeficiency virus 1 [TaxId:11676] [361175] (2 PDB entries)
  8. 3061120Domain d6n3ue_: 6n3u E: [361182]
    automated match to d5teob_

Details for d6n3ue_

PDB Entry: 6n3u (more details), 2.9 Å

PDB Description: microed structure of the ctd-sp1 fragment of hiv-1 gag with bound maturation inhibitor bevirimat.
PDB Compounds: (E:) CTD-SP1 fragment of HIV-1 Gag

SCOPe Domain Sequences for d6n3ue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n3ue_ a.28.3.1 (E:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqgvggpghkarvlaeamsqv

SCOPe Domain Coordinates for d6n3ue_:

Click to download the PDB-style file with coordinates for d6n3ue_.
(The format of our PDB-style files is described here.)

Timeline for d6n3ue_:

  • d6n3ue_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13