Lineage for d6i6zb1 (6i6z B:112-418)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2464564Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2466053Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2466054Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 2466162Protein automated matches [190397] (2 species)
    not a true protein
  7. 2466163Species Human (Homo sapiens) [TaxId:9606] [188484] (6 PDB entries)
  8. 3061111Domain d6i6zb1: 6i6z B:112-418 [361173]
    Other proteins in same PDB: d6i6za2, d6i6zb2
    automated match to d2v77a_
    complexed with tje

Details for d6i6zb1

PDB Entry: 6i6z (more details), 1.72 Å

PDB Description: crystal structure of the human carboxypeptidase a1 in complex with the phosphinic inhibitor acetyl-tyr-ala-y(po2ch2)-homophe-oh
PDB Compounds: (B:) Carboxypeptidase A1

SCOPe Domain Sequences for d6i6zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i6zb1 c.56.5.1 (B:112-418) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rstdtfnyatyhtleeiydfldllvaenphlvskiqigntyegrpiyvlkfstggskrpa
iwidtgihsrewvtqasgvwfakkitqdygqdaaftaildtldifleivtnpdgfafths
tnrmwrktrshtagslcigvdpnrnwdagfglsgassnpcsetyhgkfansevevksivd
fvkdhgnikafisihsysqllmypygyktepvpdqdeldqlskaavtalaslygtkfnyg
siikaiyqasgstidwtysqgikysftfelrdtgrygfllpasqiiptaketwlalltim
ehtlnhp

SCOPe Domain Coordinates for d6i6zb1:

Click to download the PDB-style file with coordinates for d6i6zb1.
(The format of our PDB-style files is described here.)

Timeline for d6i6zb1:

  • d6i6zb1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13

View in 3D
Domains from same chain:
(mouse over for more information)
d6i6zb2