Lineage for d6mdha1 (6mdh A:9-77)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 3061105Species Myotis davidii [TaxId:225400] [361167] (1 PDB entry)
  8. 3061106Domain d6mdha1: 6mdh A:9-77 [361168]
    Other proteins in same PDB: d6mdha3
    automated match to d5chwa1

Details for d6mdha1

PDB Entry: 6mdh (more details), 1.37 Å

PDB Description: x-ray crystal structure of isg15 from myotis davidii
PDB Compounds: (A:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d6mdha1:

Sequence, based on SEQRES records: (download)

>d6mdha1 d.15.1.0 (A:9-77) automated matches {Myotis davidii [TaxId: 225400]}
mlsnefqvpmrdsmllselkqlitqkiqvpafrqrllvqgsnevlqdgvplahqglrsgs
evvlvvqsc

Sequence, based on observed residues (ATOM records): (download)

>d6mdha1 d.15.1.0 (A:9-77) automated matches {Myotis davidii [TaxId: 225400]}
mnefqvpmrdsmllselkqlitqkiqvpafrqrllvqgsnevlqdgvplahqglrsgsev
vlvvqsc

SCOPe Domain Coordinates for d6mdha1:

Click to download the PDB-style file with coordinates for d6mdha1.
(The format of our PDB-style files is described here.)

Timeline for d6mdha1:

  • d6mdha1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13