Lineage for d6ihxb_ (6ihx B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2300379Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2300419Species Cow (Bos taurus) [TaxId:9913] [46506] (13 PDB entries)
  8. 3061103Domain d6ihxb_: 6ihx B: [361165]
    Other proteins in same PDB: d6ihxa_, d6ihxc_
    automated match to d2qssb_
    complexed with cmo, hem

Details for d6ihxb_

PDB Entry: 6ihx (more details), 1.46 Å

PDB Description: crystal structure analysis of bovine hemoglobin modified by snp
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d6ihxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ihxb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahry

SCOPe Domain Coordinates for d6ihxb_:

Click to download the PDB-style file with coordinates for d6ihxb_.
(The format of our PDB-style files is described here.)

Timeline for d6ihxb_:

  • d6ihxb_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13