Lineage for d6i36a_ (6i36 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2312410Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2312411Protein (Apo)ferritin [47246] (8 species)
  7. 2312412Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (22 PDB entries)
  8. 3061102Domain d6i36a_: 6i36 A: [361164]
    automated match to d1mfra_
    complexed with cl, fe2, mg

Details for d6i36a_

PDB Entry: 6i36 (more details), 1.59 Å

PDB Description: sixty minutes iron loaded frog m ferritin
PDB Compounds: (A:) Ferritin, middle subunit

SCOPe Domain Sequences for d6i36a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6i36a_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv

SCOPe Domain Coordinates for d6i36a_:

Click to download the PDB-style file with coordinates for d6i36a_.
(The format of our PDB-style files is described here.)

Timeline for d6i36a_:

  • d6i36a_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13