Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.9: Ubiquitin carboxyl-terminal hydrolase, UCH [82568] (6 proteins) Pfam PF00443 |
Protein Ubiquitin carboxyl-terminal hydrolase 14 [142860] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142861] (7 PDB entries) Uniprot P54578 100-482 |
Domain d6iika_: 6iik A: [361162] automated match to d2ayna1 complexed with iu1 |
PDB Entry: 6iik (more details), 1.97 Å
SCOPe Domain Sequences for d6iika_:
Sequence, based on SEQRES records: (download)
>d6iika_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} elpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdlfd smdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaiedd svketdsssasaatpskkkslidqffgvefettmkcteseeeevtkgkenqlqlscfinq evkylftglklrlqeeitkqsptlqrnalyiksskisrlpayltiqmvrffykekesvna kvlkdvkfplmldmyelctpelqekmvsfrskfkdledkkvnqqpntsdkksspqkevky epfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikfdddkvsivtpe dilrlsgggdwhiayvllygprrv
>d6iika_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} elpcgltnlgntcymnatvqcirsvpelkdalkryagalrasgemasaqyitaalrdlfd smdktsssippiillqflhmafpqfaekgeqgqylqqdanecwiqmmrvlqqkleaiedk slidqffgvefettmkcteseeeevtkgkenqlqlscfinqevkylftglklrlqeeitk qsptlqrnalyiksskisrlpayltiqmvrffnakvlkdvkfplmldmyelctpelqekm vsfrskfkdlyepfsfaddigsnncgyydlqavlthqgrssssghyvswvkrkqdewikf dddkvsivtpedilrlsgggdwhiayvllygprrv
Timeline for d6iika_: