Lineage for d6i2yb_ (6i2y B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (18 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (704 PDB entries)
  8. 3061096Domain d6i2yb_: 6i2y B: [361158]
    automated match to d5owra_
    complexed with 88z

Details for d6i2yb_

PDB Entry: 6i2y (more details), 2.56 Å

PDB Description: human stk10 bound to foretinib
PDB Compounds: (B:) serine/threonine-protein kinase 10

SCOPe Domain Sequences for d6i2yb_:

Sequence, based on SEQRES records: (download)

>d6i2yb_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvietkseeeledyiveie
ilatcdhpyivkllgayyhdgklwimiefcpggavdaimleldrgltepqiqvvcrqmle
alnflhskriihrdlkagnvlmtlegdirladfgvsaknlktlqkrdsfigtpywmapev
vmcetmkdtpydykadiwslgitliemaqiepphhelnpmrvllkiaksdpptlltpskw
svefrdflaialdknpetrpsaaqllehpfvssitsnkalrelvaeakaevmee

Sequence, based on observed residues (ATOM records): (download)

>d6i2yb_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehvrrdldpnevweivgelgdgafgkvykaknketgalaaakvieteeeledyiveieil
atcdhpyivkllgayyhdglwimiefcpggavdaimleldrgltepqiqvvcrqmlealn
flhskriihrdlkagnvlmtlegdirladfgvsaknigtpywmapevvmcetpydykadi
wslgitliemaqiepphhelnpmrvllkiaksdpptlltpskwsvefrdflaialdknpe
trpsaaqllehpfvssitsnkalrelvaeakaevmee

SCOPe Domain Coordinates for d6i2yb_:

Click to download the PDB-style file with coordinates for d6i2yb_.
(The format of our PDB-style files is described here.)

Timeline for d6i2yb_:

  • d6i2yb_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13