Lineage for d6f2zb1 (6f2z B:237-339)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (876 PDB entries)
  8. 3061094Domain d6f2zb1: 6f2z B:237-339 [361156]
    automated match to d1hzhh3
    complexed with bma, ful, gal, man, nag

Details for d6f2zb1

PDB Entry: 6f2z (more details), 2.3 Å

PDB Description: structure of a fc mutatnt
PDB Compounds: (B:) Fc fragment of antiboy

SCOPe Domain Sequences for d6f2zb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f2zb1 b.1.1.2 (B:237-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d6f2zb1:

Click to download the PDB-style file with coordinates for d6f2zb1.
(The format of our PDB-style files is described here.)

Timeline for d6f2zb1:

  • d6f2zb1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13

View in 3D
Domains from same chain:
(mouse over for more information)
d6f2zb2