Lineage for d6hqgd_ (6hqg D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (78 species)
    not a true protein
  7. 3061067Species Phenylobacterium zucineum [TaxId:450851] [361129] (1 PDB entry)
  8. 3061091Domain d6hqgd_: 6hqg D: [361153]
    automated match to d3rwla_
    complexed with hem

Details for d6hqgd_

PDB Entry: 6hqg (more details), 2.9 Å

PDB Description: cytochrome p450-153 from phenylobacterium zucineum
PDB Compounds: (D:) cytochrome p450

SCOPe Domain Sequences for d6hqgd_:

Sequence, based on SEQRES records: (download)

>d6hqgd_ a.104.1.0 (D:) automated matches {Phenylobacterium zucineum [TaxId: 450851]}
dlqraardaaysmpieeinpadpelfrtdtmwpyferlrkedpvhwgvsphedvggywsv
tkyndimavdtnhevfsseptivlpdpaddftlpmfiamdppkhdvqrktvqpivapnhl
aylepiireragkilddlpigeeinwvdkvsielttmtlatlfdfpwedrrkltfwsdva
tsapesgilgttdpeehenlrrqtlfecvdyfmrlwnervnappkpdlismlahgestkn
mdrmeylgnlillivggndttrntisgsvlalhqnpdqdrklrenpglipamvsetirwq
tplaymrrrakrdfelggktiregdkvamwyvsgnrdeevidrpndywierprvrqhlsf
gfgvhrcvgnrlaelqlkiiweeilarfprlevvgpprrvyssfvkgyeelpvviptrn

Sequence, based on observed residues (ATOM records): (download)

>d6hqgd_ a.104.1.0 (D:) automated matches {Phenylobacterium zucineum [TaxId: 450851]}
dlqraardaaysmpieeinpadpelfrtdtmwpyferlrkedpvhwgvsphedvggywsv
tkyndimavdtnhevfsseptivlpdpaddlpmfiamdppkhdvqrktvqpivapnhlay
lepiireragkilddlpigeeinwvdkvsielttmtlatlfdfpwnlrrqtlfecvdyfm
rlwnermeylgnlillivggndttrntisgsvlalhqnpdqdrklrenpglipamvseti
rwqtplaymrrrakrdfelggktiregdkvamwyvsgnrdeevidrpndywierprvrqh
lsfgfgvhrcvgnrlaelqlkiiweeilarfprlevvgpprrvyssfvkgyeelpvvipt
rn

SCOPe Domain Coordinates for d6hqgd_:

Click to download the PDB-style file with coordinates for d6hqgd_.
(The format of our PDB-style files is described here.)

Timeline for d6hqgd_:

  • d6hqgd_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13