Lineage for d6il3a_ (6il3 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (17 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (676 PDB entries)
  8. 3061090Domain d6il3a_: 6il3 A: [361152]
    automated match to d1t45a_
    complexed with a9r, cl, cxs, gol, po4

Details for d6il3a_

PDB Entry: 6il3 (more details), 2.5 Å

PDB Description: crystal structure of the flt3 kinase bound to a small molecule inhibitor
PDB Compounds: (A:) Receptor-type tyrosine-protein kinase FLT3

SCOPe Domain Sequences for d6il3a_:

Sequence, based on SEQRES records: (download)

>d6il3a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qfryesqlqmvqvtgssdneyfyvdfreyeydlkwefprenlefgkvlgsgafgkvmnat
aygisktgvsiqvavkmlkekadsserealmselkmmtqlgshenivnllgactlsgpiy
lifeyccygdllnylrskrekfsedeieyenqkrleeeedlnvltfedllcfayqvakgm
eflefkscvhrdlaarnvlvthgkvvkicdfglardimsdsnyvvrgnarlpvkwmapes
lfegiytiksdvwsygillweifslgvnpypgipvdanfykliqngfkmdqpfyateeiy
iimqscwafdsrkrpsfpnltsflgcql

Sequence, based on observed residues (ATOM records): (download)

>d6il3a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qfryesqlqmvqvtgssdneyfyvdfreyeydlkwefprenlefgkvlgsgafgkvmnat
aygisktgvsiqvavkmlkekadsserealmselkmmtqlgshenivnllgactlsgpiy
lifeyccygdllnylrskrekfsnvltfedllcfayqvakgmeflefkscvhrdlaarnv
lvthgkvvkicdfglardimsdsnyvvrgnarlpvkwmapeslfegiytiksdvwsygil
lweifslgvnpypgipvdanfykliqngfkmdqpfyateeiyiimqscwafdsrkrpsfp
nltsflgcql

SCOPe Domain Coordinates for d6il3a_:

Click to download the PDB-style file with coordinates for d6il3a_.
(The format of our PDB-style files is described here.)

Timeline for d6il3a_:

  • d6il3a_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13