Lineage for d6hl8a_ (6hl8 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2404704Family b.82.2.3: Gab protein (hypothetical protein YgaT) [63855] (2 proteins)
    automatically mapped to Pfam PF08943
  6. 2404709Protein automated matches [190931] (3 species)
    not a true protein
  7. 3061041Species Escherichia coli [TaxId:83333] [361103] (2 PDB entries)
  8. 3061082Domain d6hl8a_: 6hl8 A: [361144]
    automated match to d1jr7a_
    complexed with fe2, gua

Details for d6hl8a_

PDB Entry: 6hl8 (more details), 2.4 Å

PDB Description: crystal structure of the csid glutarate hydroxylase in complex with glutarate
PDB Compounds: (A:) Protein CsiD

SCOPe Domain Sequences for d6hl8a_:

Sequence, based on SEQRES records: (download)

>d6hl8a_ b.82.2.3 (A:) automated matches {Escherichia coli [TaxId: 83333]}
qdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddlc
anqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqyy
arfvvknvdnsdsylrqphrvmelhndgtyveeitdyvlmmkideqnmqggnslllhldd
wehldnyfrhplarrpmrfaappsknvskdvfhpvfdvdqqgrpvmryidqfvqpkdfee
gvwlselsdaietskgilsvpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfa
yasnhyqthq

Sequence, based on observed residues (ATOM records): (download)

>d6hl8a_ b.82.2.3 (A:) automated matches {Escherichia coli [TaxId: 83333]}
qdysgftltpsaqsprlleltfteqttkqfleqvaewpvqaleyksflrfrvakilddlc
anqlqplllktllnraegallinavgvddvkqademvklatavahligrsnfdamsgqyy
arfvvkhrvmelhndgtyveeitdyvlmmkideqnmqggnslllhlddwehldnyfrhpl
arrpmrfaakdvfhpvfdvdqqgrpvmryidqfvqpkdfeegvwlselsdaietskgils
vpvpvgkfllinnlfwlhgrdrftphpdlrrelmrqrgyfayasnhyqthq

SCOPe Domain Coordinates for d6hl8a_:

Click to download the PDB-style file with coordinates for d6hl8a_.
(The format of our PDB-style files is described here.)

Timeline for d6hl8a_:

  • d6hl8a_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13