Lineage for d6hbcb2 (6hbc B:148-465)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2424105Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2424106Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2424107Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (14 species)
  7. 3061062Species Synechococcus elongatus [TaxId:1140] [361124] (1 PDB entry)
  8. 3061071Domain d6hbcb2: 6hbc B:148-465 [361133]
    Other proteins in same PDB: d6hbcb1, d6hbcc1, d6hbcd_, d6hbce_
    automated match to d1rsca1

Details for d6hbcb2

PDB Entry: 6hbc (more details), 2.78 Å

PDB Description: structure of the repeat unit in the network formed by ccmm and rubisco from synechococcus elongatus
PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6hbcb2:

Sequence, based on SEQRES records: (download)

>d6hbcb2 c.1.14.1 (B:148-465) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus elongatus [TaxId: 1140]}
fqgpphgiqverdllnkygrpmlgctikpklglsaknygravyeclrggldftkddenin
sqpfqrwrdrflfvadaihksqaetgeikghylnvtaptceemmkraefakelgmpiimh
dfltagftanttlakwcrdngvllhihramhavidrqrnhgihfrvlakclrlsggdhlh
sgtvvgklegdkastlgfvdlmredhieadrsrgvfftqdwasmpgvlpvasggihvwhm
palveifgddsvlqfgggtlghpwgnapgatanrvaleacvqarnegrdlyreggdilre
agkwspelaaaldlwkei

Sequence, based on observed residues (ATOM records): (download)

>d6hbcb2 c.1.14.1 (B:148-465) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Synechococcus elongatus [TaxId: 1140]}
fqgpphgiqverdllnkygrpmlgctikpklglsaknygravyeclrggldftkddenin
sqpfqrwrdrflfvadaihksqaetgeikghylnvtaptceemmkraefakelgmpiimh
dfltagftanttlakwcrdngvllhihramhavidrqrnhgihfrvlakclrlsggdhlh
sgtvdkastlgfvdlmredhieadrsrgvfftqdwasmpgvlpvasggihvwhmpalvei
fgddsvlqfgggtlghpwgnapgatanrvaleacvqarnegrdlyreggdilreagkwsp
elaaaldlwkei

SCOPe Domain Coordinates for d6hbcb2:

Click to download the PDB-style file with coordinates for d6hbcb2.
(The format of our PDB-style files is described here.)

Timeline for d6hbcb2:

  • d6hbcb2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13