Lineage for d6hqga_ (6hqg A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (77 species)
    not a true protein
  7. 3061067Species Phenylobacterium zucineum [TaxId:450851] [361129] (1 PDB entry)
  8. 3061068Domain d6hqga_: 6hqg A: [361130]
    automated match to d3rwla_
    complexed with hem

Details for d6hqga_

PDB Entry: 6hqg (more details), 2.9 Å

PDB Description: cytochrome p450-153 from phenylobacterium zucineum
PDB Compounds: (A:) cytochrome p450

SCOPe Domain Sequences for d6hqga_:

Sequence, based on SEQRES records: (download)

>d6hqga_ a.104.1.0 (A:) automated matches {Phenylobacterium zucineum [TaxId: 450851]}
dlqraardaaysmpieeinpadpelfrtdtmwpyferlrkedpvhwgvsphedvggywsv
tkyndimavdtnhevfsseptivlpdpaddftlpmfiamdppkhdvqrktvqpivapnhl
aylepiireragkilddlpigeeinwvdkvsielttmtlatlfdfpwedrrkltfwsdva
tsapesgilgttdpeehenlrrqtlfecvdyfmrlwnervnappkpdlismlahgestkn
mdrmeylgnlillivggndttrntisgsvlalhqnpdqdrklrenpglipamvsetirwq
tplaymrrrakrdfelggktiregdkvamwyvsgnrdeevidrpndywierprvrqhlsf
gfgvhrcvgnrlaelqlkiiweeilarfprlevvgpprrvyssfvkgyeelpvviptrn

Sequence, based on observed residues (ATOM records): (download)

>d6hqga_ a.104.1.0 (A:) automated matches {Phenylobacterium zucineum [TaxId: 450851]}
dlqraardaaysmpieeinpadpelfrtdtmwpyferlrkedpvhwgvsphedvggywsv
tkyndimavdtnhevfsseptivlpdpaddftlpmfiamdppkhdvqrktvqpivapnhl
aylepiireragkilddlpigeeinwvdkvsielttmtlatlfdfpwnlrrqtlfecvdy
fmrlwnemeylgnlillivggndttrntisgsvlalhqnpdqdrklrenpglipamvset
irwqtplaymrrrakrdfelggktiregdkvamwyvsgnrdeevidrpndywierprvrq
hlsfgfgvhrcvgnrlaelqlkiiweeilarfprlevvgpprrvyssfvkgyeelpvvip
trn

SCOPe Domain Coordinates for d6hqga_:

Click to download the PDB-style file with coordinates for d6hqga_.
(The format of our PDB-style files is described here.)

Timeline for d6hqga_:

  • d6hqga_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13