Lineage for d6hqdc_ (6hqd C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (79 species)
    not a true protein
  7. 3061056Species Pseudomonas sp. [TaxId:1084570] [361118] (1 PDB entry)
  8. 3061058Domain d6hqdc_: 6hqd C: [361120]
    automated match to d5fyfb_
    complexed with gol, hem, pge, srt

Details for d6hqdc_

PDB Entry: 6hqd (more details), 1.8 Å

PDB Description: cytochrome p450-153 from pseudomonas sp. 19-rlim
PDB Compounds: (C:) cytochrome p450

SCOPe Domain Sequences for d6hqdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hqdc_ a.104.1.0 (C:) automated matches {Pseudomonas sp. [TaxId: 1084570]}
piddaeiarsialedidvskpelferdglhpyferlrredpvhyckaseygpywsitkfs
divaidtnhkvfssdhtngsfvlddttlnavdggiylpnflgmdppkhdvhrmvvspiva
pqnllrfeatirertkrvlselpigeefnwvdrvsielttmmlatlldfpfddrrkltrw
sdiittrpgyglvdsweqreselmeclayfqrlyaerqamppkpdlismlahspemqdlt
ptdflgtlallivggndttrssmsgsamachlypqefdkvrnnrallasvipevvrwqtp
iahmrrtaledvefrgkqirkgdkvvmwylsgnrddevidrpmdfiadrprarhhlsfgf
gihrclgnrlaelqlkilweemcerysrievcgepvrvpsnlvhgyidipvrlha

SCOPe Domain Coordinates for d6hqdc_:

Click to download the PDB-style file with coordinates for d6hqdc_.
(The format of our PDB-style files is described here.)

Timeline for d6hqdc_:

  • d6hqdc_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13