Lineage for d6hqdb_ (6hqd B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (79 species)
    not a true protein
  7. 3061056Species Pseudomonas sp. [TaxId:1084570] [361118] (1 PDB entry)
  8. 3061057Domain d6hqdb_: 6hqd B: [361119]
    automated match to d5fyfb_
    complexed with gol, hem, pge, srt

Details for d6hqdb_

PDB Entry: 6hqd (more details), 1.8 Å

PDB Description: cytochrome p450-153 from pseudomonas sp. 19-rlim
PDB Compounds: (B:) cytochrome p450

SCOPe Domain Sequences for d6hqdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hqdb_ a.104.1.0 (B:) automated matches {Pseudomonas sp. [TaxId: 1084570]}
daeiarsialedidvskpelferdglhpyferlrredpvhyckaseygpywsitkfsdiv
aidtnhkvfssdhtngsfvlddttlnavdggiylpnflgmdppkhdvhrmvvspivapqn
llrfeatirertkrvlselpigeefnwvdrvsielttmmlatlldfpfddrrkltrwsdi
ittrpgyglvdsweqreselmeclayfqrlyaerqamppkpdlismlahspemqdltptd
flgtlallivggndttrssmsgsamachlypqefdkvrnnrallasvipevvrwqtpiah
mrrtaledvefrgkqirkgdkvvmwylsgnrddevidrpmdfiadrprarhhlsfgfgih
rclgnrlaelqlkilweemcerysrievcgepvrvpsnlvhgyidipvrlha

SCOPe Domain Coordinates for d6hqdb_:

Click to download the PDB-style file with coordinates for d6hqdb_.
(The format of our PDB-style files is described here.)

Timeline for d6hqdb_:

  • d6hqdb_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13