Lineage for d6exrb_ (6exr B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438674Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2438675Protein automated matches [190131] (75 species)
    not a true protein
  7. 3061003Species Pyrococcus horikoshii [TaxId:70601] [361065] (1 PDB entry)
  8. 3061053Domain d6exrb_: 6exr B: [361115]
    automated match to d3a10a_

Details for d6exrb_

PDB Entry: 6exr (more details), 2.16 Å

PDB Description: chemotaxis protein chey from pyrococcus horikoshii
PDB Compounds: (B:) 120aa long hypothetical chemotaxis protein (CheY)

SCOPe Domain Sequences for d6exrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6exrb_ c.23.1.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
arvlvvddaafmrmllkkiltqaghevvgeasngkeavekykqlkpdlvtmdivmpemdg
itavkeimkidpnakiimitavgqeakvmealksgakgyivkpfqaqkvieevnrvl

SCOPe Domain Coordinates for d6exrb_:

Click to download the PDB-style file with coordinates for d6exrb_.
(The format of our PDB-style files is described here.)

Timeline for d6exrb_:

  • d6exrb_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13