Lineage for d6gndd_ (6gnd D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879390Species Clostridium acetobutylicum [TaxId:272562] [361111] (2 PDB entries)
  8. 2879393Domain d6gndd_: 6gnd D: [361113]
    automated match to d1xfla_
    complexed with edo, fad

Details for d6gndd_

PDB Entry: 6gnd (more details), 2.89 Å

PDB Description: crystal structure of the complex of a ferredoxin-flavin thioredoxin reductase and a thioredoxin from clostridium acetobutylicum at 2.9 a resolution
PDB Compounds: (D:) thioredoxin

SCOPe Domain Sequences for d6gndd_:

Sequence, based on SEQRES records: (download)

>d6gndd_ c.47.1.0 (D:) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
esifdeeiktsgepvivdfwapwcgpskmlgpiidelsedldgkakftkvnvdenpgias
kfgiasiptvmifkdgnpvetlvgfrpkqsitasiekhm

Sequence, based on observed residues (ATOM records): (download)

>d6gndd_ c.47.1.0 (D:) automated matches {Clostridium acetobutylicum [TaxId: 272562]}
esifdeeikepvivdfwapwcgpskmlgpiidelsedlgkakftkvnvdenpgiaskfgi
asiptvmifkdgnpvetlvgfrpkqsitasiekhm

SCOPe Domain Coordinates for d6gndd_:

Click to download the PDB-style file with coordinates for d6gndd_.
(The format of our PDB-style files is described here.)

Timeline for d6gndd_: