Lineage for d6bthb1 (6bth B:0-133)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395948Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2396280Protein automated matches [190295] (6 species)
    not a true protein
  7. 2396296Species Human (Homo sapiens) [TaxId:9606] [187133] (62 PDB entries)
  8. 3061044Domain d6bthb1: 6bth B:0-133 [361106]
    Other proteins in same PDB: d6btha2, d6bthb2
    automated match to d1eiia_
    complexed with ecb, peg

Details for d6bthb1

PDB Entry: 6bth (more details), 1.35 Å

PDB Description: crystal structure of human cellular retinol binding protein 2 (crbp2) in complex with 2-arachidonoylglycerol (2-ag)
PDB Compounds: (B:) Retinol-binding protein 2

SCOPe Domain Sequences for d6bthb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bthb1 b.60.1.2 (B:0-133) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtrdqngtwemesnenfegymkaldidfatrkiavrltqtkvidqdgdnfktkttstfrn
ydvdftvgvefdeytksldnrhvkalvtwegdvlvcvqkgekenrgwkqwiegdklylel
tcgdqvcrqvfkkk

SCOPe Domain Coordinates for d6bthb1:

Click to download the PDB-style file with coordinates for d6bthb1.
(The format of our PDB-style files is described here.)

Timeline for d6bthb1:

  • d6bthb1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13

View in 3D
Domains from same chain:
(mouse over for more information)
d6bthb2