Lineage for d6f0ba_ (6f0b A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (77 species)
    not a true protein
  7. 3061010Species Streptomyces acidiscabies [TaxId:1116232] [361072] (2 PDB entries)
  8. 3061025Domain d6f0ba_: 6f0b A: [361087]
    automated match to d4z5pa_
    complexed with c8h, hem

Details for d6f0ba_

PDB Entry: 6f0b (more details), 2.8 Å

PDB Description: cytochrome p450 txtc employs substrate conformational switching for sequential aliphatic and aromatic thaxtomin hydroxylation
PDB Compounds: (A:) cytochrome p450 monooxygenase

SCOPe Domain Sequences for d6f0ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f0ba_ a.104.1.0 (A:) automated matches {Streptomyces acidiscabies [TaxId: 1116232]}
splepyhiypeakscpvakvglwngtpahvfsgyedvrtvlqdrrfssdsrrpnfteltp
tlqsqaaappfvrtdnpdhrrlrgtiareflpkhiellrpaireivqgvldglaetappq
dmleafavpvasatvfrllgipaedralltrcvkgvvsavgsedegaevfrtlgeyiggl
vqdpselpedslirrlvtgpyqekqltfhetigvilmlivggydttastislslvsyalq
pekfsvvhehperipllveellryhtvsqlglgriatedvevggvtvragqmvvaalpla
nrdesvfpnpdeldfdrpsvphvgfgygphqcvgqalarvelqeaipavirrlpgmrlac
aledlpfrhdmatygihelpmtw

SCOPe Domain Coordinates for d6f0ba_:

Click to download the PDB-style file with coordinates for d6f0ba_.
(The format of our PDB-style files is described here.)

Timeline for d6f0ba_:

  • d6f0ba_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13