Lineage for d6buvb_ (6buv B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2861043Species Mycobacterium tuberculosis [TaxId:83332] [269137] (14 PDB entries)
  8. 2861056Domain d6buvb_: 6buv B: [361085]
    automated match to d4ymib_
    complexed with cl, e9a, na

Details for d6buvb_

PDB Entry: 6buv (more details), 1.86 Å

PDB Description: structure of mycobacterium tuberculosis nadd in complex with inhibitor [(1~{r},2~{r},5~{s})-5-methyl-2-propan-2-yl-cyclohexyl] 2-[3-methyl- 2-(phenoxymethyl)benzimidazol-1-yl]ethanoate
PDB Compounds: (B:) nicotinate mononucleotide adenylyltransferase NadD

SCOPe Domain Sequences for d6buvb_:

Sequence, based on SEQRES records: (download)

>d6buvb_ c.26.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehrylmtvi
atasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqgweel
felarfvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsrplwy
lmpdgvvqyvskrrlyt

Sequence, based on observed residues (ATOM records): (download)

>d6buvb_ c.26.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehrylmtvi
atasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqgweel
felarfvgvsrpghitsllgqlakdaltlveipalaisstdcrqraeqsrplwylmpdgv
vqyvskrrlyt

SCOPe Domain Coordinates for d6buvb_:

Click to download the PDB-style file with coordinates for d6buvb_.
(The format of our PDB-style files is described here.)

Timeline for d6buvb_: