Lineage for d6f1ga_ (6f1g A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397987Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2397997Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2397998Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
    automatically mapped to Pfam PF04616
  6. 2398050Protein automated matches [191033] (3 species)
    not a true protein
  7. 2398051Species Geobacillus stearothermophilus [TaxId:1422] [188852] (6 PDB entries)
  8. 3061021Domain d6f1ga_: 6f1g A: [361083]
    automated match to d3cu9a_
    complexed with ahr, ca, so4

Details for d6f1ga_

PDB Entry: 6f1g (more details), 1.67 Å

PDB Description: the structure of abnb-e201a, an intracellular 1,5-alpha-l-arabinanase from geobacillus stearothermophilus, in complex with arabinopentaose
PDB Compounds: (A:) Intracellular endo-alpha-(1->5)-L-arabinanase

SCOPe Domain Sequences for d6f1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f1ga_ b.67.2.1 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mvhfhpfggvnfyemdwslkgdlwahdpviakegsrwyvfhtgsgiqiktsedgvhwenm
gwvfpslpdwykqyvpekdedhlwapdicfyngiyylyysvstfgkntsviglatnqtld
prdpdyewkdmgpvihstasdnynaidpnvvfdqegqpwlsfgsfwsgiqliqldtetmk
paaqaelltiasrgeepnaiaapfivcrngyyylfvsfdfccrgiestykiavgrskdit
gpyvdkngvsmmqgggtildegndrwigpghcavyfsgvsailvnhaydalkngeptlqi
rplywddegwpylsv

SCOPe Domain Coordinates for d6f1ga_:

Click to download the PDB-style file with coordinates for d6f1ga_.
(The format of our PDB-style files is described here.)

Timeline for d6f1ga_:

  • d6f1ga_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13