Lineage for d6c89c_ (6c89 C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555981Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2555982Protein automated matches [190418] (23 species)
    not a true protein
  7. 2556001Species Escherichia coli [TaxId:562] [226145] (15 PDB entries)
  8. 3061012Domain d6c89c_: 6c89 C: [361074]
    automated match to d4u4lb_
    complexed with cl, edo, gol, na, zn

Details for d6c89c_

PDB Entry: 6c89 (more details), 1.75 Å

PDB Description: ndm-1 beta-lactamase exhibits differential active site sequence requirements for the hydrolysis of penicillin versus carbapenem antibiotics
PDB Compounds: (C:) Beta-lactamase

SCOPe Domain Sequences for d6c89c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6c89c_ d.157.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
dqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqil
nwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhslt
faangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclirdskakslaqlg
dadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d6c89c_:

Click to download the PDB-style file with coordinates for d6c89c_.
(The format of our PDB-style files is described here.)

Timeline for d6c89c_:

  • d6c89c_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13