Lineage for d6a35c_ (6a35 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922594Family c.124.1.0: automated matches [191609] (1 protein)
    not a true family
  6. 2922595Protein automated matches [191112] (17 species)
    not a true protein
  7. 2922738Species Pyrococcus horikoshii [TaxId:70601] [361003] (2 PDB entries)
  8. 2922743Domain d6a35c_: 6a35 C: [361061]
    automated match to d1t9ka_

Details for d6a35c_

PDB Entry: 6a35 (more details), 2.65 Å

PDB Description: crystal structure of 5-methylthioribose 1-phosphate isomerase from pyrococcus horikoshii ot3 - form ii
PDB Compounds: (C:) Putative methylthioribose-1-phosphate isomerase

SCOPe Domain Sequences for d6a35c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a35c_ c.124.1.0 (C:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
meirytpkeltklprtveyknksvyminqrllpkefkvekfskveevaeaiknmtvrgap
aigaaagfglalyaetskaktkeefldgfekayeilkntrptavnlfwalnrikklveeh
sedpldeikrlivqeaykiadedveanlrmghygaevlpegnilthcnagslatvhlgtv
gsvvrvmhkdgslkllwldetrpvlqgarlsaweysydglnvkliadnaaafvmqqgfvd
aiivgadrivangdfankigtymlavlarehgipffavaplssidmelksgkdipieers
peevltcggcriapdvpvynpafdvtphkyltgiitdrgvvwppfkrnlkklfevn

SCOPe Domain Coordinates for d6a35c_:

Click to download the PDB-style file with coordinates for d6a35c_.
(The format of our PDB-style files is described here.)

Timeline for d6a35c_: