Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) |
Family c.124.1.0: automated matches [191609] (1 protein) not a true family |
Protein automated matches [191112] (17 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:70601] [361003] (2 PDB entries) |
Domain d6a35c_: 6a35 C: [361061] automated match to d1t9ka_ |
PDB Entry: 6a35 (more details), 2.65 Å
SCOPe Domain Sequences for d6a35c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a35c_ c.124.1.0 (C:) automated matches {Pyrococcus horikoshii [TaxId: 70601]} meirytpkeltklprtveyknksvyminqrllpkefkvekfskveevaeaiknmtvrgap aigaaagfglalyaetskaktkeefldgfekayeilkntrptavnlfwalnrikklveeh sedpldeikrlivqeaykiadedveanlrmghygaevlpegnilthcnagslatvhlgtv gsvvrvmhkdgslkllwldetrpvlqgarlsaweysydglnvkliadnaaafvmqqgfvd aiivgadrivangdfankigtymlavlarehgipffavaplssidmelksgkdipieers peevltcggcriapdvpvynpafdvtphkyltgiitdrgvvwppfkrnlkklfevn
Timeline for d6a35c_: