Lineage for d6bulb2 (6bul B:183-328)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2329494Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2329495Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2329704Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2329705Protein automated matches [226851] (38 species)
    not a true protein
  7. 2329982Species Staphylococcus aureus [TaxId:273036] [340197] (2 PDB entries)
  8. 3060998Domain d6bulb2: 6bul B:183-328 [361060]
    Other proteins in same PDB: d6bula1, d6bulb1
    automated match to d4kqxb2
    complexed with e9g, e9j, mg, nap

Details for d6bulb2

PDB Entry: 6bul (more details), 1.88 Å

PDB Description: crystal structure of staphylococcus aureus ketol-acid reductoisomerase with hydroxyoxamate inhibitor 2
PDB Compounds: (B:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d6bulb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bulb2 a.100.1.0 (B:183-328) automated matches {Staphylococcus aureus [TaxId: 273036]}
fkeetetdlfgeqavlcggvskliqsgfetlveagyqpelayfevlhemklivdlmyegg
menvrysisntaefgdyvsgprvitpdvkenmkavltdiqngnfsnrfiednkngfkefy
klreeqhghqiekvgrelremmpfik

SCOPe Domain Coordinates for d6bulb2:

Click to download the PDB-style file with coordinates for d6bulb2.
(The format of our PDB-style files is described here.)

Timeline for d6bulb2:

  • d6bulb2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13

View in 3D
Domains from same chain:
(mouse over for more information)
d6bulb1