Lineage for d6ez7a1 (6ez7 A:303-384)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518968Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2519561Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2519562Protein automated matches [190896] (11 species)
    not a true protein
  7. 2519580Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [279753] (7 PDB entries)
  8. 3060991Domain d6ez7a1: 6ez7 A:303-384 [361053]
    Other proteins in same PDB: d6ez7a2
    automated match to d2u2fa_
    complexed with peg

Details for d6ez7a1

PDB Entry: 6ez7 (more details), 1.9 Å

PDB Description: pes4 rrm3 structure
PDB Compounds: (A:) Protein PES4

SCOPe Domain Sequences for d6ez7a1:

Sequence, based on SEQRES records: (download)

>d6ez7a1 d.58.7.0 (A:303-384) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nsifiknlptittrddilnffsevgpiksiylsnatkvkylwafvtyknssdsekaikry
nnfyfrgkkllvtraqdkeera

Sequence, based on observed residues (ATOM records): (download)

>d6ez7a1 d.58.7.0 (A:303-384) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nsifiknlptittrddilnffsevgpiksiylsnatvkylwafvtyknssdsekaikryn
nfyfrgkkllvtraqdkeera

SCOPe Domain Coordinates for d6ez7a1:

Click to download the PDB-style file with coordinates for d6ez7a1.
(The format of our PDB-style files is described here.)

Timeline for d6ez7a1:

  • d6ez7a1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13

View in 3D
Domains from same chain:
(mouse over for more information)
d6ez7a2