Lineage for d6buva_ (6buv A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2443142Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2443143Protein automated matches [190459] (57 species)
    not a true protein
  7. 2443350Species Mycobacterium tuberculosis [TaxId:83332] [269137] (6 PDB entries)
  8. 3060976Domain d6buva_: 6buv A: [361038]
    automated match to d4ymib_
    complexed with cl, e9a, na

Details for d6buva_

PDB Entry: 6buv (more details), 1.86 Å

PDB Description: structure of mycobacterium tuberculosis nadd in complex with inhibitor [(1~{r},2~{r},5~{s})-5-methyl-2-propan-2-yl-cyclohexyl] 2-[3-methyl- 2-(phenoxymethyl)benzimidazol-1-yl]ethanoate
PDB Compounds: (A:) nicotinate mononucleotide adenylyltransferase NadD

SCOPe Domain Sequences for d6buva_:

Sequence, based on SEQRES records: (download)

>d6buva_ c.26.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehrylmtvi
atasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqgweel
felarfvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsrplwy
lmpdgvvqyvskrrlyt

Sequence, based on observed residues (ATOM records): (download)

>d6buva_ c.26.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehrylmtvi
atasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqgweel
felarfvgvsrpgtsllgqlakdaltlveipalaisstdcrqraeqsrplwylmpdgvvq
yvskrrlyt

SCOPe Domain Coordinates for d6buva_:

Click to download the PDB-style file with coordinates for d6buva_.
(The format of our PDB-style files is described here.)

Timeline for d6buva_:

  • d6buva_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13