Lineage for d6bu2b1 (6bu2 B:8-152)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2510574Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2510575Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2511044Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2511045Protein automated matches [190239] (23 species)
    not a true protein
  7. 3060971Species Mycobacterium tuberculosis [TaxId:83332] [361033] (1 PDB entry)
  8. 3060972Domain d6bu2b1: 6bu2 B:8-152 [361034]
    Other proteins in same PDB: d6bu2a2, d6bu2b2
    automated match to d1jc5b_
    complexed with so4

Details for d6bu2b1

PDB Entry: 6bu2 (more details), 2 Å

PDB Description: crystal structure of methylmalonyl-coa epimerase from mycobacterium tuberculosis
PDB Compounds: (B:) glyoxalase

SCOPe Domain Sequences for d6bu2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bu2b1 d.32.1.0 (B:8-152) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
harhmlatslvtgldhvgiavadldvaiewyhdhlgmilvheeinddqgireallavpgs
aaqiqlmapldessviakfldkrgpgiqqlacrvsdldamcrrlrsqgvrlvyetarrgt
ansrinfihpkdaggvlielvepap

SCOPe Domain Coordinates for d6bu2b1:

Click to download the PDB-style file with coordinates for d6bu2b1.
(The format of our PDB-style files is described here.)

Timeline for d6bu2b1:

  • d6bu2b1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13

View in 3D
Domains from same chain:
(mouse over for more information)
d6bu2b2