Lineage for d6b4sa1 (6b4s A:29-263)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2403752Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2404400Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2404401Protein automated matches [190388] (27 species)
    not a true protein
  7. 3060945Species Bertholletia excelsa [TaxId:3645] [361007] (1 PDB entry)
  8. 3060948Domain d6b4sa1: 6b4s A:29-263 [361010]
    automated match to d5wpwa1

Details for d6b4sa1

PDB Entry: 6b4s (more details), 2.04 Å

PDB Description: crystal structure of brazil nut (bertholletia excelsa) allergen ber e 2
PDB Compounds: (A:) 11S globulin

SCOPe Domain Sequences for d6b4sa1:

Sequence, based on SEQRES records: (download)

>d6b4sa1 b.82.1.0 (A:29-263) automated matches {Bertholletia excelsa [TaxId: 3645]}
yecriqrltaqepqyrleaeagvsevwdytdqqfrcagvaalrntirpqglllpvytnap
klyyvtqgrgilgvlmpgcpetfqsmsqfqgsreqeeergrfqdqhqkvhhlkkgdiiai
pagvalwcyndgdedlvtvlvqhtasdlnqldqnprhfflagniqrsqkqrgeryglrgg
qqiladnvfkgfnmealadvlgfgmdtetarkvrgeddqrghivrveqglkvirp

Sequence, based on observed residues (ATOM records): (download)

>d6b4sa1 b.82.1.0 (A:29-263) automated matches {Bertholletia excelsa [TaxId: 3645]}
yecriqrltaqepqyrleaeagvsevwdytdqqfrcagvaalrntirpqglllpvytnap
klyyvtqgrgilgvlmpgcpetfqsdqhqkvhhlkkgdiiaipagvalwcyndgdedlvt
vlvqhtasdlnqldqnprhfflagnladnvfkgfnmealadvlgftetarkvrgeddqrg
hivrveqglkvirp

SCOPe Domain Coordinates for d6b4sa1:

Click to download the PDB-style file with coordinates for d6b4sa1.
(The format of our PDB-style files is described here.)

Timeline for d6b4sa1:

  • d6b4sa1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-13

View in 3D
Domains from same chain:
(mouse over for more information)
d6b4sa2
View in 3D
Domains from other chains:
(mouse over for more information)
d6b4sb1