Lineage for d6a22e_ (6a22 E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2336455Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2336456Protein automated matches [191142] (6 species)
    not a true protein
  7. 2336469Species Human (Homo sapiens) [TaxId:9606] [189274] (73 PDB entries)
  8. 3060943Domain d6a22e_: 6a22 E: [361005]
    automated match to d3l0la_
    complexed with 9p6

Details for d6a22e_

PDB Entry: 6a22 (more details), 2.55 Å

PDB Description: ternary complex of human ror gamma ligand binding domain with compound t.
PDB Compounds: (E:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d6a22e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a22e_ a.123.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
lelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpiv

SCOPe Domain Coordinates for d6a22e_:

Click to download the PDB-style file with coordinates for d6a22e_.
(The format of our PDB-style files is described here.)

Timeline for d6a22e_:

  • d6a22e_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-13