Lineage for d6igef_ (6ige F:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409884Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2411049Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 2411050Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 2411120Protein automated matches [191200] (9 species)
    not a true protein
  7. 3060760Species Human papillomavirus type 33 [TaxId:10586] [360822] (1 PDB entry)
  8. 3060939Domain d6igef_: 6ige F: [361001]
    automated match to d5y9ea_

Details for d6igef_

PDB Entry: 6ige (more details), 2.9 Å

PDB Description: crystal structure of human papillomavirus type 33 pentamer
PDB Compounds: (F:) Major capsid protein L1

SCOPe Domain Sequences for d6igef_:

Sequence, based on SEQRES records: (download)

>d6igef_ b.121.6.1 (F:) automated matches {Human papillomavirus type 33 [TaxId: 10586]}
skvvstdeyvsrtsiyyyagssrllavghpyfsiknptnakkllvpkvsglqyrvfrvrl
pdpnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisghpllnkfddtetgnkypg
qpgadnreclsmdykqtqlcllgckpptgehwgkgvastnaapandcpplelintiiedg
dmvdtgfgcmdfktlqanksdvpidicgstckypdylkmtsepygdslffflrreqmfvr
hffnragklgeavpddlyikgsgttasiqssaffptpsgsmvtsesqlfnkpywlqraqg
hnngicwgnqvfvtvvdttrstnmtlctqvtsdstyknenfkeyirhveeydlqfvfqlc
kvtltaevmtyihamnpdiledwqfgltpppsaslqdtyrfvtsqaitcqktvppkeked
plgkytfwevdlkekfsadldqfplgrkfllqagl

Sequence, based on observed residues (ATOM records): (download)

>d6igef_ b.121.6.1 (F:) automated matches {Human papillomavirus type 33 [TaxId: 10586]}
skvvstdeyvsrtsiyyyagssrllavghpyfsiknptkkllvpkvsglqyrvfrvrlpd
pnkfgfpdtsfynpdtqrlvwacvgleigrgqplgvgisghpllnkfddtetgnkypgqp
gadnreclsmdykqtqlcllgckpptgehwgkgvasandcpplelintiiedgdmvdtgf
gcmdfktlqanksdvpidicgstckypdylkmtsepygdslffflrreqmfvrhffnrag
klgeavpddlyikgsgttasiqssaffptpsgsmvtsesqlfnkpywlqraqghnngicw
gnqvfvtvvdttrstnmtlctqvtsdstyknenfkeyirhveeydlqfvfqlckvtltae
vmtyihamnpdiledwqfedplgkytfwevdlkekfsadldqfplgrkfllqagl

SCOPe Domain Coordinates for d6igef_:

Click to download the PDB-style file with coordinates for d6igef_.
(The format of our PDB-style files is described here.)

Timeline for d6igef_:

  • d6igef_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-06