Lineage for d5ztka_ (5ztk A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576670Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2576671Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2576948Family f.13.1.0: automated matches [227143] (1 protein)
    not a true family
  6. 2576949Protein automated matches [226845] (16 species)
    not a true protein
  7. 2577038Species Nonlabens marinus [TaxId:1454201] [319523] (9 PDB entries)
  8. 3060930Domain d5ztka_: 5ztk A: [360992]
    automated match to d5g28a_
    complexed with cl, ola, ret

Details for d5ztka_

PDB Entry: 5ztk (more details), 1.75 Å

PDB Description: synchrotron structure of light-driven chloride pump having an ntq motif
PDB Compounds: (A:) Chloride pumping rhodopsin

SCOPe Domain Sequences for d5ztka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ztka_ f.13.1.0 (A:) automated matches {Nonlabens marinus [TaxId: 1454201]}
knieslfdysagqfefidhlltmgvgvhfaalifflvvsqfvapkyriatalscivmvsa
glilnsqavmwtdayayvdgsyqlqdltfsngyryvnwmatipclllqllivlnlkgkel
fstatwlilaawgmiitgyvgqlyevddiaqlmiwgavstaffvvmnwivgtkifknrat
mlggtdstitkvfwlmmfawtlypiaylvpafmnnadgvvlrqllftiadisskviyglm
ityiaiqqsaaagyvpaqqalgri

SCOPe Domain Coordinates for d5ztka_:

Click to download the PDB-style file with coordinates for d5ztka_.
(The format of our PDB-style files is described here.)

Timeline for d5ztka_:

  • d5ztka_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-06