Lineage for d5w2qa2 (5w2q A:260-416)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488301Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2488302Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2489065Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2489066Protein automated matches [196909] (68 species)
    not a true protein
  7. 2489488Species Mycobacterium tuberculosis [TaxId:1773] [196910] (12 PDB entries)
  8. 3060925Domain d5w2qa2: 5w2q A:260-416 [360987]
    automated match to d2wgea2
    complexed with 6u5, gol, ipa, na, tce

Details for d5w2qa2

PDB Entry: 5w2q (more details), 1.8 Å

PDB Description: crystal structure of mycobacterium tuberculosis kasa in complex with 6u5
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d5w2qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w2qa2 c.95.1.0 (A:260-416) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
kplarllgagitsdafhmvapaadgvragramtrslelaglspadidhvnahgtatpigd
aaeanairvagcdqaavyapksalghsigavgalesvltvltlrdgvipptlnyetpdpe
idldvvageprygdyryavnnsfgfgghnvalafgry

SCOPe Domain Coordinates for d5w2qa2:

Click to download the PDB-style file with coordinates for d5w2qa2.
(The format of our PDB-style files is described here.)

Timeline for d5w2qa2:

  • d5w2qa2 appears in periodic updates to SCOPe 2.07 starting on 2018-12-06

View in 3D
Domains from same chain:
(mouse over for more information)
d5w2qa1