Lineage for d5ywea1 (5ywe A:2-75)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2455762Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2456272Protein Class sigma GST [81362] (5 species)
  7. 2456285Species Human (Homo sapiens) [TaxId:9606] [89705] (11 PDB entries)
    Uniprot O60760
    synonym: hematopoietic prostaglandin D synthase
  8. 3060920Domain d5ywea1: 5ywe A:2-75 [360982]
    Other proteins in same PDB: d5ywea2, d5yweb2, d5ywec2, d5ywed2
    automated match to d2cvda2
    complexed with gol, gsh, mg

Details for d5ywea1

PDB Entry: 5ywe (more details), 1.68 Å

PDB Description: crystal structure of hematopoietic prostaglandin d synthase apo form
PDB Compounds: (A:) hematopoietic prostaglandin d synthase

SCOPe Domain Sequences for d5ywea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ywea1 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOPe Domain Coordinates for d5ywea1:

Click to download the PDB-style file with coordinates for d5ywea1.
(The format of our PDB-style files is described here.)

Timeline for d5ywea1:

  • d5ywea1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-06