Lineage for d5yxkb1 (5yxk B:1-109)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2344781Protein CD86 (b7-2), N-terminal domain [63635] (1 species)
  7. 2344782Species Human (Homo sapiens) [TaxId:9606] [63636] (3 PDB entries)
  8. 3060908Domain d5yxkb1: 5yxk B:1-109 [360970]
    Other proteins in same PDB: d5yxka2, d5yxkb2, d5yxkc2, d5yxkd2
    automated match to d1ncna_

Details for d5yxkb1

PDB Entry: 5yxk (more details), 1.9 Å

PDB Description: high resolution crystal structure of human b7-2 igv domain in p21 space group
PDB Compounds: (B:) T-lymphocyte activation antigen CD86

SCOPe Domain Sequences for d5yxkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yxkb1 b.1.1.1 (B:1-109) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymgr
tsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla

SCOPe Domain Coordinates for d5yxkb1:

Click to download the PDB-style file with coordinates for d5yxkb1.
(The format of our PDB-style files is described here.)

Timeline for d5yxkb1:

  • d5yxkb1 appears in periodic updates to SCOPe 2.07 starting on 2018-12-06