Lineage for d5z6ub_ (5z6u B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2415941Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2415942Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2416303Protein automated matches [190169] (7 species)
    not a true protein
  7. 3060837Species Scheffersomyces stipitis [TaxId:322104] [360899] (2 PDB entries)
  8. 3060899Domain d5z6ub_: 5z6u B: [360961]
    automated match to d1mi3a_
    complexed with gol

Details for d5z6ub_

PDB Entry: 5z6u (more details), 1.95 Å

PDB Description: crystal strcuture of d-xylose reductase from scheffersomyces stipitis
PDB Compounds: (B:) NAD(P)H-dependent D-xylose reductase

SCOPe Domain Sequences for d5z6ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z6ub_ c.1.7.1 (B:) automated matches {Scheffersomyces stipitis [TaxId: 322104]}
mpsiklnsgydmpavgfgcwkvdvdtcseqiyraiktgyrlfdgaedyaneklvgagvkk
aidegivkredlfltsklwnnyhhpdnvekalnrtlsdlqvdyvdlflihfpvtfkfvpl
eekyppgfycgkgdnfdyedvpiletwkaleklvkagkirsigvsnfpgallldllrgat
ikpsvlqvehhpylqqprliefaqsrgiavtayssfgpqsfvelnqgralntsplfenet
ikaiaakhgkspaqvllrwssqrgiaiipksntvprllenkdvnsfdldeqdfadiakld
inlrfndpwdwdkipifv

SCOPe Domain Coordinates for d5z6ub_:

Click to download the PDB-style file with coordinates for d5z6ub_.
(The format of our PDB-style files is described here.)

Timeline for d5z6ub_:

  • d5z6ub_ appears in periodic updates to SCOPe 2.07 starting on 2018-12-06