SCOPe 2.08: Domain d5zjpb_: 5zjp B:

Lineage for d5zjpb_ (5zjp B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.5: NanE-like [117362] (1 protein)
   Pfam PF04131

6. Protein Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE [117363] (3 species)

7. Species Vibrio cholerae [TaxId:666] [357870] (2 PDB entries)

8. Domain d5zjpb_: 5zjp B: [360943]
   automated match to d1yxya1
   complexed with edo, peg, pge, rfw

Details for d5zjpb_

PDB Entry: 5zjp, 2.66 Å

PDB Description: structure of n-acetylmannosamine-6-phosphate-2-epimerase from vibrio cholerae with n-acetylglucosamine-6-phosphate

PDB Compounds: (B:) Putative N-acetylmannosamine-6-phosphate 2-epimerase

SCOPe Domain Sequences for d5zjpb_:

Sequence; same for both SEQRES and ATOM records:

>d5zjpb_ c.1.2.5 (B:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Vibrio cholerae [TaxId: 666]}
knflnieelkrflngqtvvsiqpvtgspldktdfivamaiaveqagakalriegvsnvaa
vsaavtipiigivkrdlpdspvritpfvsdvdglanagatviafdatnrtrpesreriaq
aikntgcfamadcstfedglwansqgveivgstlsgyvgdieptvpdfqlvkafseagff
tmaegryntpelaakaiesgavavtvgsaltrlevvtqwfnnatqaager

Timeline for d5zjpb_:

• d5zjpb_ first appeared in SCOPe 2.07